Em formação

Quais são os diferentes tipos de hélices nas estruturas secundárias das proteínas e como eles diferem?

Quais são os diferentes tipos de hélices nas estruturas secundárias das proteínas e como eles diferem?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Quais são os diferentes tipos de hélices nas estruturas secundárias das proteínas e como são diferenciadas?

Nos documentos DSSP, os tipos de hélices mencionados são: Alpha-Helix, Helix-3 e Helix-5.

Nos documentos STRIDE, os tipos de hélices mencionados são: Alpha-Helix, 3-10 Helix, PI-Helix.

Por que o DSSP tem Helix-3 e Helix-5, enquanto STRIDE tem 3-10 Helix e PI-Helix - são expressões diferentes para a mesma coisa?

Quais são as diferenças entre esses tipos de hélices, quais são seus nomes científicos completos para que eu possa ler mais sobre eles, e existem outros tipos de hélices não mencionados aqui?


Esta página DSSP deixa claro que:

Helix-3 = 3-10 hélice

Helix-5 = π-hélice

o α-hélice é descrito em todos os livros de bioquímica e amplamente na web. Possui 3,6 resíduos por volta helicoidal e 13 átomos no anel formado pela ligação de hidrogênio e, portanto, também pode ser chamada de hélice 3,6-13.

o 3-10 hélice é menos comum do que a α-hélice, mas ainda é comum. Por analogia com a nomenclatura alternativa descrita para a α-hélice, ela possui 3 resíduos por volta helicoidal em um anel de 10 átomos.

o hélice π é ainda menos comum. É uma hélice mais larga com 4,6 resíduos por volta.

Uma comparação dos três pode ser encontrada neste artigo de proteopédia, do qual tirei a ilustração abaixo.

Existe também o hélice tripla de colágeno, mas isso é específico do colágeno, enquanto os outros são exemplos gerais de estrutura secundária encontrada em muitas proteínas.

Nomenclatura Padrão

Não existe um “nome científico completo” nesta área da biologia molecular. Os nomes tendem a ser padronizados por acordo não oficial quando a ambigüidade se torna um problema. As outras hélices além da α-hélice não são muito conhecidas, mas os termos 3-10 hélice e π-hélice são certamente mais comuns do que Helix-3 e Helix-5, o que suspeito pode ter sido uma conveniência computacional. No entanto, uma pesquisa na Internet indica que, para revistas científicas 310-hélice é geralmente preferido a 3-10 hélice ou 3 (10) -helix, estas últimas talvez refletindo o trabalho em um ambiente de texto simples ou o processamento de texto ou limitações de HTML dos escritores.


A volta do parafuso: um exercício na estrutura secundária de proteínas

É apresentado um exercício usando tiras de papel simples para ilustrar as estruturas helicoidais da proteína e as estruturas secundárias da folha. Baseando-se no rico contexto histórico do uso de modelos físicos em bioquímica de proteínas pelos primeiros praticantes, em particular Linus Pauling, o objetivo desta atividade é cultivar nos alunos um senso prático e intuitivo da estrutura secundária da proteína e complementar o comum retratos estruturais baseados em computador, freqüentemente usados ​​no ensino de bioquímica. À medida que os alunos dobram essas tiras de papel em estruturas secundárias de modelo, eles compreenderão melhor como as ligações de hidrogênio intramoleculares se formam no dobramento de um polipeptídeo em uma estrutura secundária e como essas ligações de hidrogênio direcionam a forma geral das estruturas helicoidais e de folha, incluindo a destreza do α-hélice e a diferença entre torção direita e esquerda. BIOCHEMISTRY AND MOLECULAR BIOLOGY EDUCATION Vol. 39, No. 3, pp. 221–225, 2011.

Uma das alegrias da bioquímica é a maneira como padrões simples de formas repetidas vezes sem conta podem se estender, crescer e emergir na complexidade da vida. Tecnologias como Jmol [1] e outros visualizadores de estrutura dão acesso quase instantâneo a representações interativas de estruturas macromoleculares em alta definição, alta resolução, zoom e rotação como a placa gráfica do usuário e largura de banda podem suportar . A capacidade de trazer vídeos semelhantes aos de jogos para o laptop de um estudante de graduação é um gancho envolvente para o estudo das estruturas de proteínas e ácidos nucléicos.

No entanto, antes de Jmol e seus ancestrais, como Chime e Rasmol, os visualizadores da estrutura molecular consistiam em modelos físicos cuidadosamente feitos. À medida que o trabalho dos cristalógrafos avançava para macromoléculas cada vez maiores, aqueles que trabalharam no campo emergente da biologia estrutural precisavam de alguma maneira de visualizar seus sujeitos moleculares em três dimensões. Os mais visionários deles, pares como John Kendrew e Max Perutz, Linus Pauling e Robert Corey, e James Watson e Francis Crick, viraram modelos de pau ou bola e pau de madeira e metal. Provavelmente, o mais famoso é aquele preservado na fotografia de Watson e Crick olhando para seu modelo de dupla hélice - uma pesquisa de imagens de Watson e Crick no Google irá puxá-lo. De bolas de madeira e parafusos de metal na década de 1950 aos modernos de plástico (mais coloridos e convenientemente mais flexíveis), os modelos moleculares apelam para a intuição tátil, visual e espacial de uma maneira verdadeiramente prática que um mouse de computador não pode, e permanece um único forma estética e funcional de, literalmente, compreender estruturas de proteínas e ácidos nucléicos.

Ao ensinar estrutura secundária de proteínas, muitas vezes faço os alunos prepararem aminoácidos modelo usando modelos moleculares "Darling" (que são usados ​​em nosso curso de química orgânica, por isso estão familiarizados com minhas aulas de bioquímica) e, em seguida, juntá-los por meio de ligações amida em polipeptídeos, dobrando-os em estruturas de hélice α e folha pregueada β. No entanto, existe uma grande quantidade de rotação de ligação possível envolvida, e a conexão entre um determinado conjunto de ângulos de ligação Φ e Ψ nem sempre é imediata. Em relação à modelagem por computador e também aos modelos moleculares, a dobra de papel no estilo origami para visualizar a estrutura da proteína é instrutiva e acessível (e barata). Ele também tem um precedente histórico na descoberta de estruturas de proteínas. Em 1948, Linus Pauling, tendo estabelecido sua carreira em físico-química na Cal Tech, voltou suas atenções para as moléculas biológicas e estava passando um ano como professor visitante em Oxford, na Inglaterra. Como se poderia esperar de um californiano na Inglaterra, parece que ele pegou um forte resfriado e passou alguns dias na cama. Pauling relatou que, entediado durante sua recuperação, ele começou a pensar e esboçar estruturas polipeptídicas prováveis ​​com base na suposição de uma ligação trans-amida planar ligando aminoácidos individuais configurados de forma idêntica, com o objetivo de contabilizar a ligação de hidrogênio completa entre o hidrogênio da amida e átomos de oxigênio [2]. Os artigos de Pauling armazenados na Oregon State University incluem uma cópia de um de seus esboços, com instruções para girar o papel em espiral para ligar o hidrogênio a cada átomo de hidrogênio da amida ao átomo de oxigênio da amida do aminoácido a quatro resíduos de distância, no que agora chamaríamos uma α-hélice [3].

Eu queria usar uma cópia do esboço de Pauling como um exercício de classe como uma introdução ao dobramento de proteínas, mas descobri que o esboço produzia, todas as vezes e, eventualmente, de forma bastante frustrante, uma hélice canhota. Uma hélice canhota é aquela que tem torção oposta a um parafuso convencional "apertado à direita". Uma comparação do esboço dobrado de Pauling com uma imagem de uma proteína α-hélice de qualquer livro de bioquímica confirmará que o esboço de Pauling é a imagem espelhada da hélice de proteína convencional.

Pauling entendeu errado? Parece que sim - que o esboço em arquivo na Oregon State University não foi anormalmente invertido em relação ao pensamento de Pauling na época, mas é consistente com a maneira como ele imaginou a hélice. A inspiração de Pauling na cama doente foi parte de uma colaboração contínua que ele teve com Robert Corey na estrutura da proteína com base em dados cristalográficos. Seu trabalho viu a luz em uma série de sete artigos consecutivos na edição de 15 de maio de 1951 dos Proceedings of the National Academy of Sciences (PNAS). A série de artigos, e um resumo de sua história e contexto, foram publicados online pela PNAS [4]. O primeiro artigo [5] descreve os parâmetros cristalográficos esperados da α-hélice (que eles chamaram de hélice de 3,7 resíduos), bem como da hélice π (então chamada de hélice de 5,1 resíduos), mas não faz distinção entre a hélice esquerda - e versões destras de cada um. O segundo artigo [6] apresenta estruturas de vários polipeptídeos homopoliméricos sintéticos com conclusões baseadas na simetria de célula unitária cristalográfica e comprimento de repetição favorecendo a α-hélice, mas sem comentários sobre a lateralidade da hélice. Na verdade, as hélices π e α são ilustradas em suas versões para canhotos.

O terceiro artigo [7] apresenta a estrutura da folha β-pregueada da proteína da seda, onde a lateralidade não é um problema. O quarto e o quinto artigos [8, 9] enfocam as queratinas, que são corretamente deduzidas como sendo α-helicoidais por natureza, e cada representação dessas hélices é canhota. O sexto [10] apresenta a hélice tripla espiralada de colágeno, que é na verdade canhota e é retratada no artigo PNAS como tal. O sétimo artigo [11] trata da estrutura da hemoglobina, argumentando com precisão por um conteúdo altamente β-helicoidal, mas evitando o comprometimento quanto à lateralidade.

Pauling e Corey pareciam ter considerado a possibilidade de qualquer sentido helicoidal. Em um artigo publicado, também na PNAS, poucos meses antes da obra-prima de sete em linha, os dois, com Harvey Branson, publicaram detalhes da hélice α / 3.7 e da hélice π / 5.1 baseados exclusivamente na geometria de a ligação peptídica, mostrando a hélice α com uma torção para a esquerda e a hélice π com uma torção para a direita. Eles estão surpreendentemente lado a lado nas figuras dois e três deste artigo, tão diferentes quanto os pedais de bicicleta direito e esquerdo, mas nenhum comentário sobre a diferença é feito. A ambigüidade helicoidal das representações de hélices α de Pauling e Corey parece não ter suscitado muitos comentários desde 1951, na verdade, encontrei apenas uma publicação comentando sobre isso, em um ensaio de Jack Dunitz em Angewante Chemie [12]. Dunitz observa a rotação para a esquerda da α-hélice mostrada no artigo PNAS de Pauling, Corey e Branson, e aponta que a torção das hélices apresentadas, bem como a estereoquímica absoluta dos próprios aminoácidos, foi atribuída arbitrariamente . Em 1951, a capacidade de atribuir inequivocamente estereoquímica absoluta estava apenas entrando em cena. Antes dessa época, a estereoquímica era acessível apenas em uma base relativa. As regras de Fisher distinguiam carboidratos D e L (e, por extensão, aminoácidos), mas qual enantiômero de, digamos, glicose ou alanina, era o que, em termos do que o aluno de química orgânica de hoje aprende como convenção R / S Cahn-Ingold-Prelog não pôde ser determinado. Dunitz destaca que, por volta de 1950, os químicos haviam, de fato, descoberto como usar a cristalografia para determinar a estereoquímica absoluta, mas isso era notícia de última hora na época. Ele conclui que "ou Pauling não estava ciente desses desenvolvimentos quando escreveu o artigo da hélice α ou sabia sobre eles, mas não estava interessado."

Dada a curiosidade intelectual inata de Pauling, parece difícil acreditar que ele não tenha pensado na questão da torção helicoidal, e suspeito que ele e Corey estavam simplesmente protegendo suas apostas. Isso provavelmente foi sábio, pois só mais de 10 anos depois que a análise cuidadosa dos ângulos de ligação de aminoácidos por Ramachandran mostrou como a conformação local dos ângulos Φ e Ψ de um aminoácido individual leva à preferência do destro em vez do canhoto hélices polipeptídicas entregues a diferença é bastante sutil.

Minha intenção inicial com este artigo era simplesmente compartilhar um exercício de dobramento de proteínas que achei útil, mas o desvio feito pela estereoquímica aqui é uma viagem que vale a pena para a bioquímica de graduação em alunos. Embora colocar as ferramentas modernas de interação da estrutura de proteína e ácido nucléico nas mãos dos alunos (ou computadores) seja empolgante e eficaz, é útil se afastar das estruturas em toda sua glória colorida e lembrar que elas existem apenas por causa da criatividade e trabalho árduo de muitos cientistas ao longo dos anos. É também um bom lembrete de que, agora como em 1951, nossas representações de moléculas são interpretações - incompletas e sempre sujeitas a revisão.

Os modelos de papel apresentados aqui facilitam uma investigação sobre as maneiras pelas quais uma matriz de resíduos de aminoácidos configurados uniformemente em uma cadeia polipeptídica pode se reunir em estruturas helicoidais ou planas de uma forma que permite que átomos de amida de hidrogênio e oxigênio formem ligações de hidrogênio peptídeo-peptídeo . Esta investigação fornece uma experiência de aprendizagem ativa que pode ser colocada em um curso de aula tradicional ou como parte de um formato de curso não tradicional. É flexível por ser adaptável a um ambiente individual ou cooperativo / colaborativo. Ele pressupõe um conhecimento básico de química orgânica, incluindo familiaridade com o grupo funcional amida e com a estereoquímica, como seria aprendido em um curso típico de graduação orgânica.


Tipos de 20 aminoácidos e suas estruturas

Cada um dos 20 aminoácidos tem o mesmo estrutura básica fundamental, que consiste em um átomo de carbono central, também conhecido como carbono alfa (α), ligado a um grupo amino (-NH2), um grupo carboxila (-COOH), e a um átomo de hidrogênio.

Cada aminoácido também tem outro átomo ou grupo de átomos ligados ao átomo central conhecido como Grupo R .

Nos eucariotos, existem várias cópias dos 21 aminoácidos proteinogênicos (os 20 do código genético padrão, mais a selenocisteína) dissolvidas no citoplasma de uma célula e esses aminoácidos são construídos pela célula a partir de compostos mais simples ou obtidos da dieta.

Aminoácidos essenciais para o corpo humano

Existem 9 aminoácidos essenciais que não pode ser produzida pelo corpo humano e deve ser obtido da dieta.

Uma lista desses 9 aminoácidos essenciais inclui aminoácidos como:

  1. Triptofano
  2. Metionina
  3. Valine
  4. Treonina
  5. Fenilalanina
  6. Leucina
  7. Isoleucina
  8. Lisina
  9. Histidina

Diferentes tipos de 20 aminoácidos

A natureza química da cadeia lateral determina a natureza do aminoácido (isto é, se é ácido, básico, polar ou não polar).

20 aminoácidos podem ser divididos nos próximos grupos:

  • Aminoácidos alifáticos: Alanina, glicina, isoleucina, leucina, Prolina e Valina.
  • Aminoácidos aromáticos: fenilalanina, triptofano e tirosina
  • Aminoácidos ácidos: ácido aspártico e ácido glutâmico.
  • Aminoácidos básicos: arginina, histidina e lisina.
  • Aminoácidos hidroxílicos: serina e treonina.
  • Aminoácidos contendo enxofre: citosina e metionina.
  • Aminoácidos amídicos: asparaginas e glutamina.

Site de perguntas sobre bioquímica

Conforme descrito antes, podemos distinguir nas proteínas quatro níveis organizacionais diferentes:

o estrutura secundária ou nível secundário de organização foi definida como a conformação presente em uma região local do polipeptídeo ou proteína, estabilizada por meio de ligações de hidrogênio entre os elementos da ligação peptídica.

As estruturas secundárias organizadas são mantidas por ligações de hidrogênio entre diferentes grupos peptídicos, ou seja, entre o grupo N-H de uma ligação peptídica e um grupo C = O de outra ligação peptídica.

Pauling e Corey, ao estudarem as possíveis estruturas secundárias das proteínas, descreveram que as principais estruturas que fazem parte desse nível de organização deveriam ter as seguintes características (Postulados de Pauling e Corey):

• Todos os aminoácidos pertencem à série L estérica

• O grupo de peptídeos é plano e em configuração trans

• Todo oxigênio carbonílico e nitrogênio amida estão envolvidos na formação de ligações de hidrogênio

• Rotação da molécula apenas em torno dos átomos de carbono alfa

• Os hidrogênios ligados por hidrogênio ficam perto de uma linha que une os átomos de oxigênio e nitrogênio envolvidos na formação da ligação

• A cadeia lateral R dos aminoácidos não está envolvida na estrutura

As estruturas que são consideradas neste nível secundário de organização incluem :

Beta-curvas (também conhecidas como Beta-bends, também conhecidas como hairpin bends)

Estrutura secundária não repetitiva

Hélice alfa

É o nível secundário de organização de proteínas em que a estrutura polipeptídica é firmemente enrolada em torno de um eixo imaginário como uma estrutura espiral. (Arranjo helicoidal da cadeia peptídica)

Neste clipe, Linus Pauling descreve como descobriu a alfa-hélice:

Características estruturais da Alpha-Helix :

& # 8211 Existem 3,6 aminoácidos por volta da hélice.

& # 8211 Cada ligação peptídica é trans e planar

& # 8211 Os grupos N-H de todas as ligações peptídicas apontam na mesma direção, que é aproximadamente paralela ao eixo da hélice

& # 8211 C = O grupos de todas as ligações peptídicas apontam na direção oposta, e também paralelos ao eixo da hélice

& # 8211 O grupo C = O de cada ligação peptídica é ligado por hidrogênio ao grupo N-H da ligação peptídica a quatro unidades de aminoácidos dele

& # 8211 Todos os grupos R apontam para fora da hélice

A estabilidade da alfa-hélice é afetada por diferentes fatores, que incluem:

1. & # 8211 interação eletrostática entre aminoácidos sucessivos com grupos R carregados.

2. & # 8211 o volume dos grupos R adjacentes

3. & # 8211 Interações entre grupos R espaçados com 3 ou 4 resíduos separados.

Cerca de 1/4 de todos os resíduos de aminoácidos em polipeptídeos são encontrados em alfa-hélices, a fração exata variando muito de uma proteína para a próxima

Observe neste exemplo as estruturas de hélice alfa em calmoludin:

Folha pregueada beta

Esta estrutura secundária foi definida como o nível secundário de organização de proteínas em que a espinha dorsal da cadeia peptídica (fitas beta) é estendida em um arranjo em zigue-zague semelhante a uma série de pregas, com as ligações peptídicas organizadas em planos de inclinações alternadas (alternando direção ascendente e descendente). A folha pregueada Beta pode ser formada entre duas cadeias peptídicas ou entre diferentes segmentos da mesma cadeia peptídica.

As características da folha pregueada Beta incluem

1. & # 8211 Cada ligação peptídica é plana e tem a conformação trans

2.- Os grupos C = O e N-H de ligações peptídicas de cadeias adjacentes apontam um para o outro e estão no mesmo plano, de modo que a ligação de hidrogênio é possível entre eles

3.- Todos os grupos R em qualquer cadeia se alternam, primeiro acima, depois abaixo do plano da folha, etc.

Existem dois tipos de folhas pregueadas Beta:

Antiparalelo: quando as cadeias polipeptídicas adjacentes correm na direção oposta

Paralelo: cadeias polipeptídicas adjacentes correndo na mesma direção

Normalmente, o segmento de polipeptídeos que mostra uma conformação Beta são chamados individualmente de fitas beta, e são representados por uma seta apontando na direção em que a fita segue (do grupo amino para o carboxila)

Ambos os modelos são encontrados em proteínas, mas a estrutura antiparalela é mais estável do que a folha beta paralela.

O conteúdo da conformação beta nas proteínas é muito variável: a mioglobina, por exemplo, não apresenta esse tipo de estrutura secundária, enquanto 45% dos aminoácidos na quimiotripsina são parte de uma conformação beta.

É importante notar que nem toda a cadeia polipeptídica faz parte de uma conformação alfa-hélice ou beta. Existem também curvas, segmentos irregularmente enrolados ou formando trechos estendidos: a carboxipeptidase, por exemplo, mostra 38% dos aminoácidos formando alfa-hélice e 27% formando estruturas beta, conseqüentemente cerca de 35% dos resíduos não estão incluídos nessas estruturas secundárias .

É o nível secundário de organização da proteína que permite a mudança de direção da cadeia peptídica para obter uma estrutura dobrada.

Eles são conhecidos como voltas reversas, curvas em grampo ou loops ômega. Ocorrem frequentemente em 5 resíduos de aminoácidos ou menos e ficam na superfície da proteína porque são hidrofílicos. Os laços beta permitem a compactação da proteína, uma vez que os aminoácidos hidrofóbicos tendem a estar no interior da proteína, enquanto os resíduos hidrofílicos interagem com o meio aquoso.

Observe na figura a seguir como as estruturas de alfa-hélice e beta-conformações (fitas beta representadas por setas) estão ligadas por curvas e voltas beta que tornam esta proteína compacta

Diferentes aminoácidos favorecem diferentes tipos de estruturas secundárias: enquanto a alanina, o glutamato e a leucina têm uma propensão a estar em hélices α, a valina e a isoleucina aparentemente favorecem as fitas β, e a glicina, asparagina e a prolina tendem a estar presentes nas voltas beta.

Se você estiver interessado em obter mais informações sobre a estrutura secundária, este seria um artigo muito interessante para começar:

A descoberta da α-hélice e da folha β, as principais características estruturais das proteínas


Papéis da interação eletrostática em proteínas

Mais de 60 anos após as análises de Linderstrom-Lang e Kirkwood de suas hipotéticas estruturas de 'proteínas', temos agora uma infinidade de evidências experimentais e estimativas computacionais das forças eletrostáticas em proteínas, com muitas estruturas 3D de proteínas em resolução atômica. Nesse ínterim, surgiram, no início, muitos argumentos e sugestões sobre o papel da eletrostática, principalmente a partir de achados e tendências empíricas. Alguns resultados experimentais indicaram que a contribuição eletrostática é da ordem de várias kcal / mol, o que era teoricamente difícil de reproduzir corretamente, porque um grande campo de reação oposto deveria ser subtraído de um grande campo Coulombic direto. Embora a importância do campo de reação tenha sido reconhecida até 70 anos atrás, aplicações adequadas às moléculas de proteínas foram feitas apenas nesta década, com o desenvolvimento da computação numérica. Agora, uma superfície molecular eletrostática é uma das imagens mais populares em revistas de biologia estrutural, indicando que a força eletrostática é um dos componentes importantes que contribuem para o reconhecimento molecular, que é um dos principais focos da biologia e bioquímica atuais. O desenvolvimento de técnicas de RMN possibilitou observar as ionizações individuais de grupos ionizáveis ​​em uma proteína, além da determinação da estrutura 3D. Uma vez que não requer nenhuma sonda adicional, cada estado de carga pode relatar os potenciais eletrostáticos muito locais e heterogêneos trabalhando na proteína, sem perturbar o campo original. A partir dos valores de pKa, as contribuições das interações eletrostáticas, pares de íons, interações carga-dipolo e ligações de hidrogênio para a estabilidade da proteína foram avaliadas corretamente. A engenharia de proteínas também fornece muito mais informações do que as obtidas com as proteínas nativas, já que os resíduos em questão podem agora ser facilmente substituídos por outros resíduos de aminoácidos com características eletrostaticamente diferentes. Esses resultados experimentais revelaram contribuições menores do que o esperado, provavelmente porque subestimamos os efeitos do campo de reação. Especialmente, um único par de íons estabiliza uma proteína apenas ligeiramente, embora uma rede cooperativa de ponte de sal possa contribuir significativamente para a estabilidade da proteína. Estabilidades marginais de proteínas surgem de pequenas diferenças entre muitos fatores com forças motrizes e opostas. Apesar da pequena contribuição de cada interação eletrostática única para a estabilidade da proteína, a soma de suas ações funciona para manter a estrutura 3D específica da proteína. Os papéis 'negativos' da eletrostática, que podem desestabilizar a conformação das proteínas, devem ser apontados. Cargas enterradas não pareadas são energeticamente muito caras para saírem no núcleo hidrofóbico. Os doadores e aceitadores de ligações de hidrogênio isolados também exercem efeitos negativos, mas não são tão caros quanto as cargas enterradas não emparelhadas, com custos de algumas kcal / mol. Portanto, as análises estatísticas das estruturas da proteína 3D revelam apenas raros casos de doadores e aceitadores de ligações de hidrogênio isolados. Esta deve ser a principal razão pela qual alfa-hélices e folhas beta são observadas apenas em núcleos de proteínas como estruturas de base. Essas estruturas secundárias não deixam quaisquer doadores ou aceitadores de hidrogênio da estrutura principal desemparelhados, devido ao seu empacotamento intrinsecamente regular. Caso contrário, pode ser muito difícil construir uma estrutura de backbone, em que todos os grupos amida e carbonil do backbone tenham seus próprios parceiros de ligação de hidrogênio no núcleo da proteína. Existem duas abordagens teóricas para a eletrostática de proteínas, o modelo macroscópico ou contínuo e o modelo microscópico ou molecular. Conforme descrito neste artigo, o modelo macroscópico tem problemas inerentes porque o sistema proteína-solvente é muito heterogêneo do ponto de vista físico.


Estrutura da Proteína

Existem quatro níveis distintos de estrutura da proteína.

A estrutura primária é a sequência de diferentes aminoácidos em uma proteína.

A estrutura secundária refere-se a subestruturas locais altamente regulares. Dois tipos principais de estrutura secundária, a hélice alfa e a fita beta.

A estrutura terciária é a estrutura tridimensional de uma molécula de proteína.

A estrutura quaternária é um conjunto maior de várias moléculas de proteína.

1. Estrutura primária:

As proteínas são grandes moléculas feitas de aminoácidos que se ligam covalentemente para formar um polímero:

o estrutura primáriarefere-se à sequência linear da cadeia de aminoácidos. A estrutura primária é mantida unida por ligações covalentes (a ligação peptídica).

Qual é o grupo funcional formado (ligação peptídica)?

Qual é o produto secundário formado?

É o backbone principal (polar ou apolar)? Marque com um círculo.

A estrutura da proteína primária é um exemplo de um [polímero ou um conjunto supramolecular] ? Marque com um círculo.

2a. Estruturas secundárias e folhas beta ndash

Proteínas se dobram em uma ou mais conformações espaciais específicas & ndash estrutura secundária. O IMF mantém as estruturas secundárias no lugar entre os grupos funcionais da espinha dorsal.

As folhas beta consistem em fitas beta(mostrado abaixo) conectado lateralmente pelo FMI, formando uma folha pregueada geralmente torcida.

O que é o FMI que mantém essas duas vertentes juntas?

Indique claramente na imagem acima quais átomos estão envolvidos nesses IMFs.

As folhas beta podem ser paralelas (duas vertentes correndo na mesma direção) ou antiparalelas (direções opostas.

Decida quais das imagens abaixo são paralelas e quais são antiparalelas.

2b. Estruturas Secundárias: Hélices Alfa

o alfa hélice (& alfa-hélice)é outro exemplo de estrutura secundária de proteínas.

A hélice alfa é uma conformação em espiral na qual cada espinha dorsal da proteína completa uma espiral completa a cada ___________ resíduos.

Novamente, as forças intermoleculares da espinha dorsal da proteína mantêm esse motivo estrutural no lugar.

O que é que o FMI está segurando esta fita em uma bobina?

Indique claramente na imagem acima quais átomos estão envolvidos nesses IMFs.

2c. Estruturas Secundárias: Hélices Alfa

Um gráfico de roda helicoidal é uma representação bidimensional dos resíduos de uma hélice alfa onde você está olhando para baixo do eixo.

Esta é uma roda helicoidal para a sequência:

abcdeABCDE123456789

Aqui está uma sequência real que forma uma hélice alfa:

Para os aminoácidos nesta sequência:

Crie sua roda helicoidal traçando a posição de cada aminoácido no gráfico da roda helicoidal acima, incluindo os círculos e caixas. Comece com a leucina em uma. Continue a colocar os outros aminoácidos ao redor da roda.

Se possível, crie também um modelo portátil usando limpadores de cachimbo e um tubo de isopor.

Identifique os resíduos hidrofílicos circulando-os.

Identifique os resíduos hidrofóbicos encaixotando-os.

Qual face da hélice alfa tem maior probabilidade de enfrentar uma solução aquosa?

Qual face da hélice alfa tem maior probabilidade de enfrentar o interior da proteína?

3. Estruturas terciárias

O empacotamento de elementos de estrutura secundária de proteínas em formas de unidades globulares compactas Estrutura terciáriade uma proteína. As proteínas são embaladas de forma que muito pouca água é encontrada dentro da proteína dobrada. A dobradura é impulsionada pelo inespecíficointerações hidrofóbicas (o enterro de resíduos hidrofóbicos da água).

[Hidrofóbico ou hidrofílico] é mais provável que os aminoácidos sejam encontrados na superfície da proteína. Marque com um círculo.

[Hidrofóbico ou hidrofílico] é mais provável que os aminoácidos sejam encontrados enterrados na proteína dobrada. Marque com um círculo.

Se uma cadeia lateral Val for ligada e enterrada na proteína (não exposta à água), que outras cadeias laterais de aminoácidos podem estar ao redor dela?

4. Estruturas quaternárias

Estrutura quaternáriaé a estrutura 3D de uma proteína com várias subunidades e como as subunidades se encaixam.

Se for um monômero, faça um desenho de um tetrâmero.

As subunidades são mantidas juntas, incluindo pontes de sal e ligações de hidrogênio. Identifique essas atrações do FMI na foto.

A estrutura da proteína quaternária é um exemplo de um [polímero ou um conjunto supramolecular] ? Marque com um círculo.

Dobramento de proteínas

Dobramento de proteínasé o processo pelo qual a estrutura de uma proteína assume sua forma ou conformação funcional. É o processo físico pelo qual um polipeptídeo se dobra em sua estrutura tridimensional característica e funcional a partir de uma bobina aleatória.

Desnaturação de proteínas

Desnaturaçãoé um processo no qual as proteínas perdem sua estrutura secundária ou terciária que está presente em seu estado dobrado.

Desenhe um desenho para o processo de desnaturação.

Em um nível molecular, descreva o que acontece quando uma proteína é desnaturada.

Sugira 2 a 3 coisas diferentes que podem causar desnaturação.

Se as proteínas nas células vivas forem desnaturadas, o que pode acontecer com a célula?

Problemas de prática de proteínas

Desenhe todos os estereoisômeros possíveis de treonina e atribua a nomenclatura R, S a cada um.

Desenhe a estrutura do seguinte peptídeo:

Os segmentos ( alpha ) -helical das proteínas param sempre que uma prolina é encontrada na cadeia. Sugira uma razão pela qual a prolina não é encontrada em uma hélice ( alpha ) -.

Pro é o aminoácido mais comumente encontrado em voltas ( beta ). Discuta as razões para esta observação.

Foldit é um novo jogo de computador revolucionário que permite que você contribua para pesquisas científicas importantes.

Dartnell, Lewis New Scientist. 8/11/2008, Vol. 199 (2681), páginas 36-39.

Leia sobre o jogo de dobrar proteínas no site e / ou no artigo da New Scientist.

Tente dobrar uma proteína. Verifique se o seu instrutor criou um grupo privado! https://fold.it/portal/node/996074

Um resumo (em suas próprias palavras) respondendo às seguintes perguntas:

Por que os cientistas estão interessados ​​no dobramento de proteínas?

Por que torná-lo um jogo de computador em vez de apenas um computador resolver a estrutura?

Que proteína você tentou dobrar?

Por que sua proteína foi importante?

Forneça uma captura de tela de sua tentativa. (Ou se o seu instrutor fez um grupo privado, eles poderão seguir suas tentativas).

Teoria do Receptor

o Site ativoé o sulco 3-D ou bolsa de uma enzima ou receptor onde as moléculas se ligam e sofrem uma reação química ou desencadeiam uma resposta.

Para interagir com o site ativo, o substrato:

a) deve ser mantida no sítio ativo com forças intermoleculares com as cadeias laterais de aminoácidos.

b) deve & ldquofit & rdquo no site ativo. (tamanho e geometria e orientação)

Uma. Ligação: Forças Eletrostáticas

Os substratos ligam-se a receptores e enzimas por interações covalentes ou não covalentes.

Abaixo está um desenho de uma parte de uma molécula de peptídeo (círculo interno) interagindo com uma enzima. As linhas tracejadas mostram as forças intermoleculares que prendem o substrato à enzima.

B. Vinculação: ajuste, tamanho e geometria

Receptores e enzimas têm forma tridimensional, portanto, a estrutura do substrato deve se ajustar.

C. Vinculação: Estereoquímica

Além disso, a estereoquímica faz uma grande diferença. Abaixo está um desenho de dois enantiômeros e como eles interagem com um receptor.

Quando estrutura UMA liga-se, tira o máximo proveito de todas as interações possíveis (muito parecido com uma mão em uma luva ou uma chave em uma fechadura & ndash se encaixa perfeitamente). Seu enantiômero, estrutura B, não é capaz de aproveitar todas as interações.

É Estrutura UMA ou estrutura B amarrado com mais força? Marque com um círculo.

Desenhe a projeção de Newman da Estrutura B girado 60, 120 e 180 graus.

É alguma conformação da estrutura B capaz de tirar o máximo partido de todos os bolsos de encadernação possíveis?

Apenas um isômero do composto deuterado abaixo é um substrato para uma desfosforilase que dá anti-eliminação ao Z-isômero (também mostrado abaixo).

Rotule os estereocentros com R ou S nesses dois isômeros.

Como esses isômeros estão relacionados entre si?

enantiômeros conformadores diastereômeros

Usando a teoria do receptor, explique por que apenas um desses isômeros reage com a enzima para formar um produto.

Problemas de aplicação de proteína

Ligação ao receptor nicotínico

Quanto mais interações um ligante pode ter com um receptor ou enzima, mais fortemente eles se ligam um ao outro.

A acetilcolina (estrutura mostrada abaixo) interage com um local de reconhecimento na subunidade a do receptor nicotínico.

Mostre as interações com a acetilcolina.

Stereochemistry of Drug Design.

Leia o seguinte artigo sobre a estereoquímica de um medicamento: http://www.ncbi.nlm.nih.gov/pmc/articles/PMC353039/

Desenhe um desenho que representa como um enantiômero de uma droga quiral se liga mais fortemente a uma enzima.

Forneça um exemplo de um medicamento atual que tem apenas um enantiômero ativo.

Atualmente, não há um mandato regulamentar nos Estados Unidos ou na Europa para desenvolver novos medicamentos exclusivamente como enantiômeros únicos e a empresa farmacêutica pode escolher se deseja um enantiômero racêmico ou puro para um novo medicamento. Argumente se o FDA deve ou não exigir drogas enantiomericamente puras para o mercado.

Nanotubos de peptídeos cíclicos como canais de íons de membrana

Os peptídeos cíclicos foram mostrados para se automontar nas membranas celulares para formar canais de íons seletivos para o tamanho da transmembrana e transportar moléculas biologicamente relevantes, como a glicose através da bicamada lipídica. Biophys J. Outubro 85 (4): 2287 & ndash2298 Chem. Soc. Rev., 2012, 41, 6023 e ndash6041 J. Am. Chem. Soc. 1998, 120, 4417-4424

Auto-montagem de peptídeo cíclico

A N-metilação, substituindo alguns dos H & rsquos no nitrogênio por CH3, limita o processo de automontagem a duas subunidades (forma apenas um dímero, veja a imagem abaixo).

O que está mantendo os peptídeos cíclicos empilháveis ​​juntos (veja a imagem abaixo)?

Indique isso na imagem abaixo usando linhas tracejadas ou marcador de texto.

Explique por que apenas duas subunidades podem se ligar após a N-metilação.

Nanotubos (cont.): Projeto de peptídeo cíclico

Nomeie o grupo funcional circulado no peptídeo cíclico mostrado acima.

Quantos centros quirais existem no peptídeo cíclico acima?

Quantos estereoisômeros são possíveis para este peptídeo cíclico?

Na caixa abaixo, usando cunhas e traços, desenhe duas cadeias laterais de alanina (Ala), ambas como o estereoisômero R, na estrutura do peptídeo abaixo.

No círculo abaixo, usando cunhas e traços, desenhe duas cadeias laterais de alanina (Ala), uma como R e outra como estereoisômero S, na estrutura do peptídeo abaixo.

O objetivo é fazer tubos ocos (nanotubos). Usando as fotos acima, explique por que eles precisam alternar entre os aminoácidos R e S à medida que circulam pelo peptídeo cíclico.

Por que cada peptídeo cíclico é composto de um número par de aminoácidos?

Nanotubos (cont.): Formação de canais através da membrana celular

Peptídeos cíclicos empilhados supramoleculares são usados ​​para criar canais de íons e transporte (tubos) através da membrana celular.

Os aminoácidos comumente usados ​​para fazer o peptídeo cíclico são fenilalanina (Phe), alanina (Ala), leucina (Leu).

Esses aminoácidos têm cadeias laterais que são: (circule a resposta correta)

positivamente carregado negativamente carregado polar não polar

Desenhe dois desses aminoácidos saindo do cilindro abaixo. Mostre claramente se a cadeia lateral do aminoácido está interagindo com a cabeça ou cauda da membrana celular.

Que tipo de forças intermoleculares estão segurando os cilindros na membrana celular?

Nanotubos (cont.): Transporte de íons e glicose através da membrana celular

Quando um número diferente de aminoácidos é usado para fazer o peptídeo cíclico, o tamanho dos poros (diâmetro interno) muda.

Número de aminoácidos Tamanho dos poros ( O que cabe no canal
4 4
8 8
10 13

Os estudos atuais sobre esses canais de peptídeos cíclicos de automontagem nas membranas celulares envolvem a administração de drogas e estudos antibacterianos.

Desenhe glicose em sua conformação de cadeira mais estável.

Qual é a geometria do Fe em Fe (CN)6 3- ?

Cada uma dessas três opções se encaixa bem em um dos canais listados acima. Adicione-os à tabela.

Compare o tamanho do Na+ e K +. Se você quisesse projetar um canal seletivo para Na +, quantos aminoácidos usaria?

Explorando Interações Biológicas de Macromoléculas com Íons / Pequenas Moléculas

A função biológica de macromoléculas, como DNA e proteínas, invariavelmente envolve a ligação de outras moléculas a elas. Os bioquímicos chamam essas outras moléculas ou íons de ligantes. A ligação de ligantes a proteínas e ácidos nucléicos ocorre por meio das forças intermoleculares familiares que você já estudou. Você pode visualizar essas interações visualizando a estrutura 3D do complexo macromolécula: ligante, cujas coordenadas de cristal de raios-X são depositadas no Banco de Dados de Proteínas na forma de arquivos PDB. Faça uma pesquisa no Google sobre pdb e siga os links para o RCSB Protein Data Bank. Uma vez lá, digite no ID do PDB ou nas barras de pesquisa de texto no menu superior o número do PDB para um dos complexos mostrados nas tabelas abaixo. Use irá usar um programa chamado Ligand Explore para visualizar o ligante ligado.

Inicie o Ligand Explorer: role para baixo até a seção Ligand Chemical Component no meio da página exibida para esse complexo. Selecione Ligand Explorer na linha com o nome do ligante. Um exemplo é mostrado abaixo.

Você pode ser solicitado a permitir pop-ups do site. Se for assim, permita. Você pode ter que selecionar o Ligand Explorer novamente para iniciar o programa. Continue dando permissões e seguindo prompts até que o Ligand Explorer seja aberto. Uma vez iniciado, selecione a guia Ajuda e as instruções serão abertas em um navegador. Use o mouse para ajudar a encontrar a melhor visualização das interações.

Tarefa: Cada tabela selecionará uma estrutura PDB exclusiva e apresentará um PowerPoint de uma página na aula, na qual você mostra capturas de tela (veja abaixo) com legendas claras que descrevem os IMFs envolvidos na ligação do ligante à sua proteína.

Use o Ligand Explorer: no lado esquerdo da janela do Ligand Explorer -

Os átomos de oxigênio e nitrogênio nos arquivos PDB são codificados por cores na maioria dos programas de exibição como vermelho e azul, respectivamente. As ligações H são mostradas entre um átomo de O vermelho e um átomo de N azul, que são eletronegativas e ligeiramente negativas. Os átomos de H não são exibidos em arquivos de estrutura obtidos usando cristalografia de raios-X. Suponha que haja um átomo de H em um dos átomos envolvidos em uma ligação de hidrogênio.

Capturando capturas de tela recortadas: PC: Selecione o ícone inferior esquerdo do Windows e digite Ferramenta de Recorte em Pesquisar Programas. Siga as instruções. Mac: selecione Command-Shift-4. Um cursor em forma de cruz aparecerá. Clique e arraste para selecionar a área. Quando você solta o botão do mouse, a captura de tela é salva como um arquivo PNG em sua área de trabalho.

A. Macromolécula: interações medicamentosas

Classe Macromolécula Medicamento Descrição PDB #
antibióticos D-alanil-D-alanina carboxipeptidase penicilina inibe a enzima que constrói as paredes das células bacterianas 1pwc
antiviral Protease de HIV saquinavir inibe uma enzima necessária para a maturação do HIV 1hxb
antiviral neuramidase tamiflu Tamiflu é um medicamento anti-influenza 2hu4
anticâncer DNA bleomicina liga-se ao DNA em células em crescimento ativo, muitas vezes clivando a cadeia de DNA 1mxk
anticâncer Tubulina taxol liga-se à tubulina, impedindo a ação dos microtúbulos durante a divisão celular 1jff
anticâncer DNA cisplatina liga-se e causa a reticulação do DNA que, em última análise, desencadeia a apoptose (morte celular programada). 3lpv
Sinalização celular Receptor beta-adrenérgico carazolol beta-bloqueadores se ligam e inibem o receptor adrenérgico usado para tratar doenças cardíacas 2rh1
Sinalização Celular Prostaglandina H2 sintase aspirina inibe a enzima ciclooxigenase, que produz prostaglandinas sinalizadoras de dor. 1pth
Doenças de Afluência Lipase pancreática alquil fosfonato inibe a lipase pancreática, reduzindo a quantidade de gordura que é absorvida dos alimentos. 1lpb
Doenças de Afluência HMG-CoA redutase Atorvastatina (Lipitor) inibe a HMG-CoA redutase, uma enzima envolvida na síntese do colesterol. 1hwk

B. Interações de proteína: carboidrato (CHO)

Classe Proteína Carboidrato Descrição PDB #
Lectina e ndash (proteína de ligação CHO) Concavalina A dimanose Con A é do Jack Bean e é usado para estudar e purificar proteínas de ligação a carboidratos 1I3H
transportador Permease de lactose Tiodigalactosídeo (um análogo da lactose) Escherichia coli lactose permease transporta lactose, através das membranas celulares 1pv7
Lectina humana P-Selectin SLEX (um carboidrato) SLeX, é um tetrassacarídeocarboidrato que se encontra na superfície das células. Está envolvido no reconhecimento célula a célula e é um dos antígenos mais importantes do grupo sanguíneo. A P-selectina é uma proteína encontrada nos leucócitos, 1g1r

C. Proteína: Interações lipídicas

Classe Proteína Medicamento Descrição PDB #
Ligação de ácidos graxos insolúveis nas células Proteína de ligação a lipídios adipócitos Ácido arachadônico Proteína intracelular envolvida na ciclooxigenase COX-2 da bioquímica de ácidos graxos (código PDB: 1CVU), 1adl
Ligação e transporte de ácidos graxos no sangue Albumina sérica humana ácido esteárico, A albumina é a proteína mais abundante no soro sanguíneo. Ele se liga a moléculas não polares, como ácidos graxos 1e7i
Separar os ácidos graxos das gorduras de armazenamento (triglicerídeos) Fosfolipase A2 Sulfato de octilo Libera ácido graxo de triglicerídeos. Encontrado nas células e também é secretado pelas células 3fvi

D. Proteína: Interações de moléculas pequenas

Classe Proteína Medicamento Descrição PDB #
Hormônio Receptor de estrogênio Tamoxifeno O tamoxifeno, um imitador do estrogênio, é usado para tratar o câncer, bloqueando a ação do estrogênio. 3ert
Moléculas tóxicas Glicoproteína P inibidores de hexapeptídeos cíclicos, cíclicostris- (R) -valineselenazol A proteína é a bomba molecular mais comum, removendo moléculas tóxicas (infelizmente também drogas quimioterápicas) das células. 3g60
Moléculas tóxicas Citocromo P450 Eritromicina (um antibiótico) O CYP3A4 é o citocromo p450 que desempenha o papel principal na desintoxicação de medicamentos e contribui para o metabolismo de aproximadamente 50% dos medicamentos comercializados. 2j0d
Hormônio Globlulina de ligação de hormônio sexual testosterona a testosterona é transportada dentro de proteínas carreadoras no sangue, incluindo albumina sérica e globulina de ligação de hormônio sexual, 1d2s
Hormônio domínio de ligação à testosterona tetrahidrogestrinona (THG) tetrahidrogestrinona (THG) é um esteróide anabolizante sintético. 2amb
Neurotrans Receptor de acetil colina Carbamoil colina Este receptor neurotransmissor do cérebro faz parte do sistema de receptor de ácido nicotínico 1uv6
Neurotrans Receptor de dopamina D3 humano eticloprida Estrutura do receptor D3 da dopamina humana em complexo com eticloprida, um antagonista da dopamina 3pbl

E. Proteína: Interações Metálicas

Classe Proteína íon Descrição PDB #
transporte Transferrina Ferro A transferrina carrega Fe no sangue, sequestrando-o e impedindo-o da oxidação para a forma férrica 3+ mais insolúvel 1h76
armazenar Ferritina Ferro Proteína intracelular que forma uma casca que sequestra íons Fe 1fha
Expressão genetica Gal 4 Zn Os íons Zn ajudam a estabilizar uma estrutura & ldquoZn finger & rdquo na proteína, permitindo que ela se ligue e regule a atividade do gene 1d66
Célula de sinalização para responder calmodulina cálcio Calmodulina (proteína moduladora de cálcio), ao se ligar a íons de Ca intracelulares, muda de forma e causa respostas celulares 1exr

F. Proteína: Interações de Drogas de Abuso

Escolha um ligante para analisar

Selecione, por sua vez, ligação de hidrogênio, ligação hidrofóbica, ligação H em ponte (mediada por uma molécula de água) e interação de metal. Faça uma captura de tela recortada de cada interação.

Para a renderização final, mova o botão de alternância em Selecionar Superfícies para opaco. Em seguida, altere a distância da melhor maneira para mostrar a cavidade na qual o ligante se liga. Cor por hidrofobicidade que dá duas cores que representam as partes polares e apolares da cavidade. Selecione sólido superfícies.

Esteja preparado para explicar em classe as interações mostradas em cada renderização.

Trabalho de casa cumulativo do grupo: Bioquímica e rsquos Next Top Model

Você descobriu uma nova proteína isolada de uma membrana celular. Uma verificação inicial dos bancos de dados de proteínas indica que sua sequência está intimamente relacionada às proteínas que transportam glicose através das membranas celulares.

Agora você precisará reunir outros detalhes estruturais com base em sua sequência. Este laboratório mostrará algumas das coisas que você pode fazer com um computador, mas também as limitações da previsão de estrutura.

A sequência primária da nova proteína está listada abaixo em códigos de uma letra. Neste laboratório, você fará algum trabalho no computador e, em seguida, tentará construir um modelo físico da proteína usando fio.

Existem quatro partes para a análise.

Parte 1: Hidropatia e Cruzamento de uma Membrana

Parte 2: Predição da Estrutura Secundária

Parte 3: Construindo um modelo

Parte 4: Estrutura terciária por computador (opcional)

Nomes dos membros do grupo:

MEDDDGGLCLAVLVAMFFLGIMLLPSLANPPGRKGALLFAAIFCILAILMGVSAEG PKNRGALGIVLAAALCLVAIFGLRNQQSNSDGWPILLALTAQLAALCVLLLPFFPE SPRYQKKS

Parte 1: Hidropatia e Cruzamento de uma Membrana

A maioria das proteínas ligadas à membrana atravessa a membrana celular várias vezes, então o primeiro passo é construir um gráfico de hidropatia da proteína. Isso permitirá que você calcule quantas vezes a proteína atravessa a membrana celular. A escala de hidropatia abaixo dá uma pontuação positiva para as cadeias laterais hidrofóbicas e uma pontuação negativa para as cadeias laterais hidrofílicas.

Faça um gráfico de hidropatia simples:

Para fazer um gráfico de hidropatia simples, abra um arquivo MS Excel que lhe foi enviado com o nome Next_Top_Model_Data. A coluna 1 tem a sequência de aminoácidos e a coluna 2 tem o resíduo #. Adicione pontuações de hidropatia à coluna 3 e faça um & lsquoColumn Graph & rsquo no formato 2D.

Os gráficos de hidropatia usam um valor médio dos resíduos antes e depois do resíduo em questão. No exemplo abaixo, a pontuação média de hidropatia para o ácido aspártico na célula C4 é uma média das pontuações das células C2 a C6. Você pode digitar & lsquo = average (C2: C6) & rsquo para que o Excel faça uma média na célula D4. Em seguida, arraste o canto inferior direito da célula D4 até o final da coluna. (Para os resíduos 1 e 2, não haverá valor médio.) Agora você terá uma hidropatia média para cada resíduo que abrange aquele resíduo mais os dois anteriores e os dois posteriores. Esses dados serão usados ​​para fins gráficos.

Faça um & lsquoColumn Graph & rsquo no formato 2D da hidropatia média (eixo y) e do resíduo #. O Excel pode traçar os números das linhas também, então você pode ter que clicar com o botão direito do mouse no gráfico e excluir a Série 1 ou 2 em & lsquoSelect Data & rsquo. Certifique-se de que o resíduo # está no eixo x. (No Excel 2007, pode ser necessário ir ao painel & lsquoDesign & rsquo e clicar em & lsquoSwitch Axes & rsquo.)

Responda a estas perguntas com base em seu enredo:

Do seu gráfico de hidropatia, quantas vezes a proteína parece cruzar a membrana celular? (Considere o que os valores positivos e negativos podem indicar.)

Cerca de quantos aminoácidos são necessários para atravessar uma membrana?

Se o terminal N da proteína está dentro da célula, onde os resíduos 30-35 estão localizados?

O terminal C é intracelular ou extracelular?

Considerando o que você sabe sobre a posição geral das cadeias laterais e dos átomos da cadeia principal em hélices a e fitas b, você acredita que as porções que cruzam a membrana provavelmente serão hélices a ou fitas b? (Observação: Esta pergunta será respondida mais tarde, portanto, apenas faça uma suposição / hipótese fundamentada aqui.)

Opcional: A literatura geralmente mostra gráficos de dispersão XY com uma linha conectando os pontos para hidropatia. Eles são mais comuns, mas mais difíceis de ler.

Pontuações de hidropatia de aminoácidos

Nome do Aminoácido Código de uma letra Pontuação de hidropatia
Isoleucina eu 4.5
Valine V 4.2
Leucina eu 3.8
Fenilalanina F 2.8
Cisteína C 2.5
Metionina M 1.9
Alanina UMA 1.8
Glicina G -0.4
Treonina T -0.7
Triptofano C -0.9
Serine S -0.8
Tirosina Y -1.3
Proline P -1.6
Histidina H -3.2
Ácido glutâmico E -3.5
Glutamina Q -3.5
Ácido aspártico D -3.5
Asparagina N -3.5
Lisina K -3.9
Arginina R -4.5

Referência de pontuação de hidropatia: Kyte, J. e Doolittle, R. 1982. Um método simples para exibir o caráter hidropático de uma proteína. J. Mol. Biol. 157: 105-132.

Parte 2: Predição da Estrutura Secundária

Prever a estrutura 3D diretamente de uma sequência de proteína primária é & lsquothe Santo Graal & rsquo da bioquímica. Atualmente, isso só pode ser feito se a estrutura de uma proteína muito semelhante for conhecida. Elementos estruturais secundários podem ser previstos com relativa precisão, no entanto, uma vez que estudos têm mostrado que certos aminoácidos são mais propensos a estar em hélices a ou cadeias b. Nesta parte, você pegará sua sequência e preverá alguns elementos estruturais secundários. Vou ao COÇAR, ARRANHÃO site que possui programas que realizam várias funções relacionadas às proteínas. Uma vez lá, insira seu endereço de e-mail, a sequência listada na primeira parte do laboratório e clique no botão SSPROcaixa. Em alguns minutos, você receberá um e-mail com o código de cada resíduo de aminoácido enviado. (Pode ir para o seu lixo eletrônico.)

o SSPRO a saída tem três códigos possíveis. Cole a saída abaixo.

H = Helix

E = estrutura beta estendida

C = curvas, loops e estruturas indefinidas

Responda a estas perguntas com base em sua previsão de estrutura secundária:

Como os prováveis ​​segmentos transmembranares da sequência combinam com os segmentos helicoidais do programa SCRATCH? (Pode ajudar colar os resultados do SCRATCH abaixo da sequência primária na página 1.)

Use os fatos abaixo sobre a-hélices e seus dados para estimar a espessura de uma membrana celular.

Um ( alpha )-helix dá uma volta a cada 3,6 resíduos. O passo ou avanço por volta é de 0,54 nm (nanômetros).

Os resíduos 30-33 (PPGR) parecem conectar a hélice 1 e a hélice 2. Com base no número de resíduos entre as hélices 1 e 2, que tipo de estrutura os resíduos 30-33 provavelmente representam?

A hélice 1 termina em cerca do resíduo 30, onde há uma prolina. Explique por que faz sentido que a prolina apareça perto do final de uma a-hélice. (Dica: pense no padrão de ligação H.)

Abaixo, é mostrada uma bicamada de membrana (suponha que a área abaixo dela seja dentro da célula). Copie a imagem e carregue-a no programa Paint do seu computador. (O programa está em & lsquoAccessories & rsquo na lista de programas.) No Paint, escolha o pincel com um ponto médio e desenhe a proteína com o mouse. Tente mostrar cerca de 5 voltas por hélice conforme elas atravessam a membrana. Quando terminar, salve o arquivo e cole-o de volta neste documento. Você pode excluir o original.

Parte 3: Terciário / Estrutura 3DParte 3: Terciário / Estrutura 3D

Como observado acima, a previsão da estrutura 3D é realmente desafiadora, uma vez que resíduos distantes na sequência primária podem acabar próximos uns dos outros na estrutura 3D. Nesta parte do laboratório, você tentará construir um modelo físico de sua proteína usando um fio e vários outros suprimentos. A modelo mais bonita receberá um prêmio incrível! Algumas suposições para o modelo são:

Suponha que cada resíduo de amino tenha 1 polegada de comprimento. Como a sequência tem 120 aminoácidos, você precisará de um pedaço de arame de 120 polegadas (10 pés). existem vários tipos disponíveis. Observe que alguns têm bordas um tanto afiadas.

Pinte o terminal N de azul e o terminal C é vermelho. (adicionar fita adesiva sobre o fabricante evitará manchas)

Se você construir uma hélice ( alpha ) - uma volta da hélice deve ter 3,6 polegadas de fio. As ligações H que conectam a volta em uma hélice ( alpha ) - devem ser

0,6 polegadas de distância e vão de 'laçada a laçada' na mesma hélice. experimente alguns fios curtos para adicionar alguns exemplos de H-bond.

Para laços e estruturas estendidas que não estão na membrana celular, apenas estique o fio com cada resíduo tendo 1 polegada de comprimento.

A sequência também possui 4 resíduos de cisteína que parecem estar em ligações dissulfeto. As posições aproximadas da cisteína na hélice estão listadas abaixo. Use um fio vermelho curto para fazer as ligações dissulfeto mais lógicas.

Dê uma olhada em como sua estrutura fica compactada medindo a distância entre os terminais N e C. O fio tem 10 pés se esticado.

Parte 4: Predição da estrutura terciária (opcional)

Como última peça opcional do laboratório, você pode tentar um preditor de forma 3D fornecido pelo site SCRATCH. Vou ao COÇAR, ARRANHÃO site e adicione seu endereço de e-mail e cole na sequência desde o início do laboratório. Desta vez, clique na caixa 3Dpro e você receberá um e-mail com uma previsão computadorizada da estrutura 3D. (Isso pode levar até 30 minutos e a estrutura será um anexo.) Depois de obter a estrutura, você pode movê-la com o botão esquerdo do mouse e o botão direito tem opções de cores, etc.)

Observação:Se a proteína não for exibida corretamente, clique com o botão direito na estrutura e em & lsquoDisplay & rsquo escolha & lsquoBackbone & rsquo.

4. Base Pares - & gt DNA Helices

O DNA é um polímero feito de monômeros de ácido nucléico.

O DNA é composto por um par de polímeros de fita simples que são mantidos firmemente juntos na forma de uma dupla hélice.
Pense na dupla hélice como uma escada torcida. Os lados consistem em um motivo repetitivo de açúcar-fosfato e os degraus entre os fios são pares de bases.

O DNA é uma molécula estável estabilizada por várias forças intermoleculares.

Desenhe a ligação de hidrogênio entre essas duas fitas de DNA.

Quais bases & ldquopair & rdquo umas com as outras no DNA?

Quantas ligações de hidrogênio são formadas entre cada um desses pares?

Os pares de bases AG e CT não ocorrem normalmente. Vejamos alguns motivos.

Imagine o DNA como uma escada (abaixo).

Existem dois problemas de pares AG e CT usando a imagem de escada:

A e G são muito [grandes ou pequenos], levando a _______________ de tensão.

C e T são muito [grandes ou pequenos], levando a _____________ mais fracos. Pense na lei de Coulomb.

Em termos de ligação de hidrogênio:

Compare o número de ligações de hidrogênio no par de bases A: G com o número de ligações de hidrogênio no par de bases C: G (página anterior).

Qual seria mais estável?

Problema de aplicação de par de bases de DNA

UMA cianófago é um vírus que infecta cianobactérias.

No cianófago S-2L, a diaminopurina (DAP) é usada em vez da adenina. DAP pares de base perfeitamente com timina formando 3 ligações de hidrogênio intramoleculares.

Identifique as 3 ligações de hidrogênio.

A-T forma 2 ligações de hidrogênio. Foi sugerido que a mudança da Adenina para DAP ajuda o vírus cianófago a escapar do sistema imunológico do hospedeiro bacteriano.

Proponha uma razão de como o DAP ajuda o vírus a sobreviver.

Antes de Rosalind Franklin (e Watson e Crick) determinar a estrutura do DNA, Chargaff observou que a quantidade total de A + G no DNA é igual à quantidade de C + T, independentemente do tipo de DNA. Explique esta observação.

Considere o oligômero de fita simples mostrado abaixo:

Circule os grupos funcionais de fosfato.

Coloque uma caixa ao redor do açúcar.

Desenhe a fita complementar mostrando as interações entre os pares de bases.

Uma única fita de DNA é um exemplo de [polímero ou um conjunto supramolecular] ? Marque com um círculo.

Uma dupla hélice de DNA é um exemplo de [polímero ou um conjunto supramolecular] ? Marque com um círculo.

Hélice de DNA quiral

As hélices podem ser destras ou canhotas.

Se você segurá-lo apontando para longe de você e ele girar no sentido horário se afastando, ele é destro, caso contrário, é canhoto. Esses modelos são imagens espelhadas e não podem ser convertidos um no outro por rotação.

As formas A e B de DNA são hélices destras, mas Z-DNA é uma hélice canhota.

O DNA nesta foto é uma hélice destra ou canhota?

Desnaturação de DNA

As duas fitas do DNA de dupla hélice são mantidas juntas por interações não covalentes relativamente fracas (ligação de hidrogênio e empilhamento de base) e se separam facilmente conhecido como desnaturação.A desnaturação causada pelo aquecimento é chamada de fusão do DNA. A temperatura na qual 50% da amostra de DNA é desnaturada é chamadaDerretendo temperatura (Tm).

Determine a temperatura de fusão (Tm) para três amostras de DNA

Liste todos os fatores que afetariam a Tm de uma amostra de DNA de dupla hélice

Lembre-se de que os pares de bases A: T têm duas ligações de hidrogênio e os pares de bases G: C têm três. Dado que todos os outros parâmetros são iguais, o ponto de fusão é determinado pelo teor de G: C do DNA (quanto maior o teor de G: C, maior a temperatura).

Um método muito simples para calcular o Tm teórico é atribuir 20 C para cada par A: T e 4 0C para cada par G: C. O Tm é a soma desses valores para todos os pares individuais no DNA de fita dupla.

Calcule o T teóricom para o seguinte DNA

Quando o ponto de fusão de diferentes moléculas de DNA são plotados contra o conteúdo da molécula e GC rsquos, uma linha é obtida como mostrado abaixo:

A equação linear usada para calcular o ponto de fusão de uma molécula de DNA (0C, 100 mM Na +) é: Tm = 64,9 + 0,41 * (% GC) & ndash (500 / Número do par de bases do DNA)

  • Usando a equação acima, calcule o ponto de fusão de uma molécula de DNA com 500 bp de comprimento e 50% de conteúdo de GC.

Grandes avanços na pesquisa de uma única molécula foram possíveis com o DNA marcado com fluorescência. YO-PRO (estrutura mostrada abaixo) é um corante oxazol que se liga ao DNA de fita dupla por meio do mecanismo de & ldquointercalation & rdquo (inclusão reversível entre pares de bases). Recentemente, pesquisadores relataram que a temperatura de fusão de um DNA duplex de 30 pares de bases aumentou em

20C para cada local de intercalação ocupado pelo corante YO-PRO.

  • Com base na estrutura do YO-PRO (mostrada abaixo) proponha uma explicação para o aumento da temperatura de fusão (Tm).

Complexos DNA-Proteína

O DNA é enorme e deve ser armazenado no minúsculo núcleo de uma célula. Em eucariotos, o armazenamento de DNA é realizado ligando-o a pequenas proteínas chamadas histonas.

Qual é a carga geral da molécula de DNA? _______________

Como as histonas formam uma ligação iônica com o DNA, preveja que carga você esperaria ver nas cadeias laterais das proteínas histonas.

Liste alguns aminoácidos típicos que estariam envolvidos.

Mostre uma ligação iônica entre a histona e uma fita de DNA no desenho animado:

Essa ligação dependeria da sequência de pares de bases no DNA?

Complexos DNA-Proteína

As histonas se ligam fortemente ao DNA, impedindo a transcrição.

Quando é hora de transcrever o DNA (para produzir uma proteína necessária), as histonas precisam se desenrolar do DNA.

As histonas podem ser acetiladas: acetil (CH3Os grupos CO) estão ligados às aminas.

Problemas Adicionais

O DNA tem um sulco maior e menor. Para visualizar essas ranhuras, observe o DNA neste site: http://employees.csbsju.edu/hjakubow. NAtutorial.htm

Algumas proteínas se ligam ao DNA por meio de ligações de hidrogênio. Com base no modelo, onde há mais doadores e aceitadores de ligações de hidrogênio?

Groove principal Groove menor

Veja este modelo de ligação de proteína ao DNA:

O RNA, ao contrário do DNA, usa ribose em vez de desoxirribose e uracila em vez de timina como base.

Identifique claramente a (s) diferença (s) nessas estruturas de açúcar.

Identifique claramente a (s) diferença (s) nessas estruturas de base nucléica.

A estrutura da timina e do uracil é mostrada acima. Desenhe a estrutura de outra base que poderia emparelhar com uracila em um RNA curto

Você viu como as drogas podem se ligar por meio de IMFs ao & ldquoactive site & rdquo de uma proteína e inibir a atividade da proteína. Uma nova maneira revolucionária de inibir a atividade da proteína é ligar uma molécula a RNAs que são decodificados para formar uma determinada sequência de proteína. Isso impede que a proteína seja produzida. Se o & ldquodrug & rdquo for outro RNA, este método é chamado Interferência de RNA.

A linha superior abaixo é parte de uma sequência de RNA para uma proteína específica.

Dobramento de RNA

O RNA de fita simples pode se dobrar sobre si mesmo, como as proteínas, para formar estruturas & ldquoterciárias & rdquo complicadas. Estes contêm regiões curtas de hélices de "fita dupla" ("estrutura quosecundária") estabilizadas por ligações H intramoleculares.

Uma estrutura comum encontrada no ssRNA & ldquofolded & rdquo é uma haste / alça em gancho mostrada abaixo.

Usando as abreviações de base de RNA: A, G, C e U, adicione bases de RNA à estrutura em grampo abaixo, o que permitiria a formação de um grampo de cabelo estável.

A alça na haste / grampo de cabelo pode servir como um local de reconhecimento para uma proteína.

Desenhe um desenho de uma proteína interagindo com uma alça de um ssRNA dobrado que tem 3 trechos diferentes de dsRNA.

Problema de aplicação de RNA

Quanto mais longo o RNA, mais difícil é prever estruturas de haste / grampo, uma vez que muitas são possíveis. Os programas de computador podem fazer isso por nós.

Vá para o servidor da Web mFold em http://mfold.rna.albany.edu/?q=mfold

Selecione o link RNA Folding Form no canto superior esquerdo

Insira um nome para a estrutura de teste (use Teste)

Insira a seguinte sequência de RNA de fita simples (listada em pares triplos para facilitar a entrada de dados):

GAG ACA UCC AUU GAU ACA CGG GUU UUA UUU AUC AAU GGA UGU CUC

Deixando todas as outras opções com seus valores padrão, role para baixo e selecione FOLD RNA

Na janela de saída, selecione para Estrutura 1 um arquivo de imagem (jpg, png) e imprima-o.

Faça duas alterações diferentes na estrutura que aumentariam ou diminuiriam a estabilidade do grampo de cabelo. Execute novamente a análise. Imprima ambos.

Uma equação química poderia ser escrita para o dobramento de RNA (assim como fizemos para a interconversão de formas de cadeira de ciclohexano substituídas)

O & DeltaE para esta reação pode ser encontrado na parte inferior do arquivo de saída (dG = x). Use a seguinte fórmula (como você fez para a interconversão da cadeira) para encontrar o Keq e a% dobrada


Quais são os diferentes tipos de hélices nas estruturas secundárias das proteínas e como eles diferem? - Biologia

Biology 2960 Computer Laboratory

Secundário estruturas são estruturas ordenadas formadas por ligações de hidrogênio internas entre resíduos de aminoácidos. As estruturas secundárias comuns são a hélice alfa, a fita beta e vários loops e voltas. Mais informações são fornecidas abaixo sobre estruturas secundárias.

Terciário estrutura de um polipeptídeo é a conformação tridimensional formando regiões distintas, independentemente dobradas, chamadas domínios. O domínio na figura abaixo é a "bolsa de ligação ao heme" para a subunidade beta da hemoglobina.

Uma única ligação de hidrogênio intra-helicoidal não forneceria estabilidade estrutural apreciável, mas o efeito cumulativo de muitas ligações de hidrogênio dentro de uma hélice alfa estabiliza essa conformação. As ligações de hidrogênio entre os resíduos de aminoácidos são especialmente estáveis ​​no interior hidrofóbico de uma proteína, onde as moléculas de água são obstruídas e, portanto, não podem competir pelas ligações de hidrogênio.

As cadeias laterais dos aminoácidos em uma hélice alfa apontam para fora do cilindro da hélice. A estabilidade de uma hélice alfa é afetada pela identidade das cadeias laterais. Alguns resíduos de aminoácidos são encontrados em conformações com mais freqüência do que outros. Por exemplo, a alanina tem uma pequena cadeia lateral sem carga e se ajusta bem à conformação em hélice alfa. Os resíduos de alanina são prevalentes nas hélices alfa de todas as classes de proteínas. Em contraste, tirosina e asparagina com suas cadeias laterais volumosas são menos comuns em hélices alfa. A glicina, cuja cadeia lateral é um único átomo de hidrogênio, desestabiliza as estruturas alfa-helicoidais, uma vez que a rotação em torno de seu carbono alfa é tão irrestrita. Por esse motivo, muitas hélices começam ou terminam com resíduos de glicina. A prolina é o resíduo menos comum em uma hélice alfa porque sua cadeia lateral cíclica rígida interrompe a conformação helicoidal destra. Além disso, a prolina carece de um átomo de hidrogênio em seu nitrogênio amido e não pode participar totalmente na ligação de hidrogênio intra-helicoidal. Por estas razões, os resíduos de prolina são encontrados mais frequentemente nas extremidades das hélices alfa do que no interior.

    Folhas antiparalelas e beta
    Na folha anti-paralela, os oxigênios de carbonil do backbone e os prótons da amida do backbone estão alinhados perfeitamente para que formem ligações retas de hidrogênio. O oxigênio carbonílico e o hidrogênio amida (próton) são colocados diretamente opostos de seu parceiro de ligação de hidrogênio. As cadeias laterais apontam perpendicularmente ao plano da folha. A conformação antiparalela é a conformação mais estável e mais comum.

Centro de Aprendizagem de Ciências Naturais
Washington University - Departamento de Biologia
Copyright & cópia 2011 Wilhelm S. Cruz
Todos os direitos reservados


O que é um domínio na estrutura da proteína

Um domínio na estrutura da proteína é a estrutura terciária de uma proteína. Além disso, ele se forma, existe e funciona independentemente dos outros componentes da proteína. Embora um motivo seja formado por meio da interação de elementos estruturais secundários em uma proteína, as interações que ocorrem entre os elementos estruturais secundários são mais fortes em um domínio. Aqui, vários tipos de ligações podem se formar entre esses elementos estruturais secundários. Fora isso, o principal tipo de ligações formadas são as pontes dissulfeto. Eles também são as interações mais estáveis.

Figura 2: Três Domínios de Piruvato Quinase

Além disso, ligações iônicas ou pontes de sal também podem se formar entre os aminoácidos carregados positiva e negativamente nas estruturas secundárias. Além disso, ligações de hidrogênio podem se formar para estabilizar a estrutura terciária. Por outro lado, os domínios de proteína normalmente têm uma estrutura globular e é solúvel em água. Além disso, um domínio de proteína desempenha uma função única de uma proteína. Geralmente, quatro classes de domínios de proteína podem ser identificados como domínios 11-α, domínios 11-β, domínios α + β e domínios α / β.


Informações de Apoio

S1 Fig. Histogramas de acessibilidades relativas a solventes (RSA) de hélices e fitas nas quatro principais classes SCOP.

Os fios são significativamente mais ocultos em todas as classes, mas a diferença é particularmente grande no caso dos domínios α / β. Isso pode ser devido ao fato de que muitos domínios α / β, como barris TIM, são tipificados por um núcleo central de fitas β rodeadas por hélices α acessíveis por solvente.

S2 Fig. Distribuição dos indels nas classes SCOP.

A frequência dos indels aumenta com a diminuição da similaridade de sequência (painéis à esquerda) e é maior em hélices do que em fitas em todos os domínios α e α + β, mas não em domínios α / β (painéis à direita, usando alinhamentos em pares com 10–20 % similaridade de sequência).

S3 Fig. As bobinas são menos robustas do que as hélices ou fios.

Os painéis mostram dados obtidos a partir de alinhamentos de pares com 10-20% de similaridade de sequência, estrelas indicam diferença significativa entre hélices e fios (p & lt 0,05 após a correção de Holm-Bonferroni). Embora as bobinas sejam claramente menos conservadas, a interpretação biológica desse padrão não é direta, porque na grande maioria dos casos as hélices e as fitas mudam independentemente umas das outras, enquanto as bobinas não mudam independentemente das hélices ou fitas: quando uma fita ou hélice o resíduo muda para uma bobina, isso também é contado como uma mudança nas bobinas. Em conseqüência, a quantidade de mudança nas bobinas é próxima à soma da mudança nas hélices e fios.

S4 Fig. Os resíduos nas hélices alfa têm mais contatos do que os resíduos nas fitas beta, e as fitas têm mais contatos do que as bobinas em todas as quatro classes SCOP (ANCOVA, p & lt 2E-16).

As caixas representam intervalos de 25–75%, bigodes de 10–90%.

S5 Fig. A maior robustez das hélices não é consequência de diferentes composições de aminoácidos, os aminoácidos individuais mostram a mesma tendência.

A) Domínios totalmente alfa vs. todos beta. Os escaninhos RSA significativamente diferentes são marcados com estrelas. (Alinhamentos de pares com similaridade de sequência de 10–20%, testes de proporções, nível de significância 0,05, corrigido para comparações múltiplas com o método de Holm-Bonferroni.) B) domínios α / β. C) domínios α + β.

S6 Fig. Os aminoácidos individuais têm menos interações de resíduos não covalentes nas fitas do que nas hélices.

A) Regressões entre RSA e o número de contatos para glicina, em hélices e fitas (p & lt 2e-16 em todas as classes SCOP, ANCOVA). B) A diferença entre as interceptações de regressões RSA de contatos para hélices e fios. O efeito da estrutura secundária no número de contatos é qualitativamente o mesmo em todos os aminoácidos: as hélices têm um número significativamente maior de contatos em todos os casos (p & lt 2e-16, ANCOVA).

S7 Fig. A relação entre a distância média de contato na sequência da proteína (ou seja, o número de aminoácidos que separam dois resíduos com uma interação de resíduo não covalente na estrutura) e robustez para mutações, usando as comparações de pares com similaridade de sequência entre 10- 20%.

A) Todos os resíduos B) Resíduos de hélice com baixo número de contatos e resíduos de fios com alto número de contatos (ver Fig. 3). As estrelas indicam uma diferença significativa entre os fios e as hélices (testes de proporções, p & lt 0,05, corrigidos para comparações múltiplas com o método Holm-Bonferroni).

S8 Fig. RSA prevê consistentemente a mudança de aminoácidos melhor do que a densidade de contato de resíduos (CD).

O gráfico mostra um gráfico de dispersão da importância RSA e CD, após binning bivariada. Selecionamos todos os alinhamentos estruturais de pares de domínios SCOP com similaridade de sequência entre 45-55% (ver Fig. 1). Para cada alinhamento par a par, RSA e CD foram determinados para cada resíduo, e uma regressão logística foi feita, para determinar a relação entre a mudança de aminoácidos, RSA e CD. A mudança de aminoácidos foi tratada como uma variável binária: quando os resíduos alinhados eram idênticos, a posição foi atribuída a 0, quando não, 1. A função "varImp" do pacote "circunflexo" R foi usada para obter a importância relativa dos dois preditores para cada regressão (na escala de 0–100), que foram então plotadas e agrupadas em 2D com o pacote “hexbin” R, para maior clareza. Embora esta abordagem seja básica e não seja adequada para determinar as taxas exatas de alteração de aminoácidos, é suficiente para obter uma comparação qualitativa da importância dos dois preditores. Em geral, tanto o RSA quanto o CD prevêem relativamente mal se um aminoácido mudará ou não, no entanto, o RSA supera consistentemente o CD.

S9 Fig. Mutações pontuais que quebram a estrutura secundária são mais frequentemente localizadas perto das extremidades das unidades de estrutura secundária.

S10 Fig. Mutações sem sentido quebram hélices com menos freqüência do que fios ou espirais.

(* indica uma diferença significativa entre hélices e filamentos, corrigida para testes múltiplos com o método Holm-Bonferroni. (p & lt 0,05, testes de proporções)

S11 Fig. A alteração da estrutura secundária pode ser usada para melhorar as previsões de patogenicidade de PolyPhen-2, mesmo se nenhuma informação estrutural estiver disponível para o tipo selvagem, apenas dados previstos.

O padrão é qualitativamente semelhante ao da Fig 5C, mas as frequências de mutantes patogênicos são mais baixas, porque o PDB é tendencioso para proteínas com mutações missense patogênicas: 50% das mutações patogênicas humanas que podem ser mapeadas para uma estrutura determinada experimentalmente, mas apenas 10% das mutações neutras. (Barras de erro representam intervalos de confiança de 95%, “*” representa significância abaixo de 0,05 e significância “**” abaixo de 0,005 (testes de proporções), controlada para taxa de descoberta falsa com o método de Benjamini-Hochberg).

S12 Fig. O efeito das mutações na energia livre de dobramento (ddG) em diferentes estruturas secundárias.

As estrelas indicam diferença significativa (*: p & lt 0,05 **: p & lt 0,005), após correção para taxa de descoberta falsa (com o método de Benjamini-Hochberg). Uma vez que a grande maioria das mutações não resulta em alteração da estrutura secundária, a estrutura secundária tem apenas um pequeno efeito no ddG, no entanto, as mutações em bobinas são consistentemente mais desestabilizadoras do que as mutações em fios ou hélices, exceto para os resíduos mais enterrados sem área exposta ao solvente .

S13 Fig. Usando a RCSB Protein Comparison Tool (algoritmo CE) para fazer os alinhamentos estruturais emparelhados resulta em um padrão idêntico ao do TMalign - as hélices mudam menos com a mudança de sequência.

Os painéis mostram o mesmo que os painéis D-F na Fig 2, mas usando a ferramenta de comparação de proteínas RCSB: alinhamentos com similaridade de sequência de 10–20%, com acessibilidade relativa ao solvente (RSA) como uma covariável.


Quais são os diferentes tipos de hélices nas estruturas secundárias das proteínas e como eles diferem? - Biologia

Aminoácidos, polipeptídeos e cadeias flexíveis

Cada aminoácido carrega uma cadeia lateral (ou grupo R) que pode, em teoria, assumir muitas formas químicas diferentes, mas apenas 20-22 dessas formas são encontradas em proteínas comuns.

Apesar de suas diferenças químicas individuais, os aminoácidos (e seus grupos R) podem ser colocados em quatro "famílias" diferentes, dependendo se seus grupos R são:

Existem cerca de 5 aminoácidos que são ácidos ou básicos, e seus grupos R ionizam-se em vários pHs para produzir uma estrutura química com carga positiva ou negativa. Esses tipos de grupos R são fortemente hidrofílicos e são estabilizados quando rodeados por água.

Existem cerca de 10 aminoácidos apolares com grupos R que não são estáveis ​​quando em contato com a água. Eles são hidrofóbicos.

Cerca de 5 aminoácidos têm cadeias laterais polares, grupos R que não se ionizam ou se tornam carregados positiva ou negativamente. Estes grupos R não são fortemente hidrofílicos nem hidrofóbicos.

Os átomos em moléculas longas, como polipeptídeos, não são rigidamente fixados no espaço ou posição. As ligações covalentes que os mantêm unidos permitem que os átomos girem e assumam uma posição tridimensional na molécula, onde são mais estáveis. Esta propriedade de "rotação em torno de uma ligação" tem consequências importantes para todas as outras propriedades dos polipeptídeos e das proteínas.

Uma vez que a espinha dorsal do polipeptídeo, mantida unida por ligações peptídicas, é flexível (por causa da "rotação em torno de todas essas ligações"), a cadeia pode dobrar, torcer e flexionar em uma variedade muito grande de formas tridimensionais. Quando na água, a maioria dos polipeptídeos se dobra espontaneamente em uma forma que é estável e crítica para o papel biológico que está prestes a desempenhar.

As proteínas são moléculas muito grandes que certamente são pesadas o suficiente para afundar no fundo de uma célula se não forem suportadas. Quando um polipeptídeo é formado na água, portanto, ele não seria capaz de desempenhar qualquer tipo de papel biológico se fosse puxado de uma vez, pela gravidade, para o fundo da célula e deixado lá!

No entanto, como o polipeptídeo é uma cadeia flexível, ele pode se dobrar e se torcer em quase qualquer forma. Essa forma não é aleatória, mas o resultado de uma série de diferentes forças inter e intramoleculares entre os grupos R internos, as ligações peptídicas e o ambiente aquoso externo.

Uma das mais importantes dessas forças é a ação e interação dos grupos R de ácido hidrofílico e básico e da água circundante. Quando em um ambiente aquoso, o polipeptídeo se dobra e torce até que o número máximo de grupos R hidrofílicos seja estendido para a água onde eles são estáveis.

Isso tem dois efeitos sobre a macromolécula polipeptídica / proteica - começa a dar à molécula toda uma forma característica e também fornece um meio de suporte. Os grupos R hidrofílicos que se projetam da superfície do polipeptídeo / proteína interagem com as moléculas de água e mantêm a enorme macromolécula em suspensão. Assim, a proteína não "afunda" no fundo da célula.

Muitos dos grupos R saindo de uma cadeia polipeptídica são hidrofóbicos ou pelo menos não hidrofílicos. Ter essas cadeias laterais rodeadas por água desestabilizaria a molécula de proteína e a tornaria muito insolúvel em água.

Felizmente, as moléculas polipeptídicas podem se remodelar de forma a impedir que isso aconteça. Muitos ou a maioria dos grupos R hidrofóbicos acabam eventualmente voltados para o meio da molécula, que é o ponto mais distante da água circundante. Ao fazer isso, eles criam uma zona ou ambiente fortemente repelente à água.

Assim como as moléculas de lipídeo ou hidrocarboneto se juntam para formar uma gota de óleo ou graxa quando colocadas na água, o mesmo ocorre com os grupos R hidrofóbicos, com praticamente o mesmo efeito, a água é excluída e toda a estrutura estabilizada.

Muitas proteínas globulares, portanto, têm seus grupos R hidrofóbicos enterrados profundamente em seu núcleo, criando uma região de exclusão de água que desempenha um papel significativo na manutenção da estrutura tridimensional geral da molécula de proteína final.

Um conjunto diferente de forças está em ação dentro da própria molécula de polipeptídeo. As forças intra-moleculares atraem ou repelem partes de segmentos da cadeia de aminoácidos à medida que os vários grupos R são torcidos em proximidade uns com os outros.

A mais forte dessas forças intramoleculares é uma ligação covalente que se forma, nas circunstâncias certas, entre os dois grupos R de dois aminoácidos de cisteína.

Muitas proteínas que são secretadas pelas células, ou que se encontram na superfície das células, são "soldadas por pontos" ao longo de seu comprimento por ligações cruzadas formadas entre dois grupos de aminoácidos R contendo enxofre. As pontes dissulfeto (também chamadas de "ligações dissulfeto" ou "ligações -S-S-") são fortemente estabilizadoras, particularmente se a proteína for transportada para o exterior da célula.

Pensa-se que estes tipos de ligações cruzadas não são essenciais para criar a forma tridimensional da proteína, mas sim para mantê-las na forma correta depois de formada.

Agentes redutores químicos podem ser usados ​​para quebrar essas ligações cruzadas, abrindo-as, sem alterar materialmente a forma geral da proteína.

Padrões dobráveis
Folha pregueada beta

Embora não seja tão forte quanto uma ligação -S-S- covalente, diferentes grupos R podem e entram em contato próximo uns com os outros ao longo de dois comprimentos da mesma cadeia polipeptídica. Um grupo R carregado positivamente será atraído por um grupo R carregado negativamente em uma posição diferente na cadeia e toda a molécula será estabilizada um pouquinho mais por sua associação próxima.

No entanto, é o arranjo atômico dentro da própria ligação peptídica que dá origem a uma série de outras atrações possíveis e, portanto, unindo forças dentro do polipeptídeo.

O átomo de oxigênio no grupo carboxila C = O tem uma carga ligeiramente negativa (devido à alta eletronegatividade do átomo de oxigênio), enquanto o átomo de hidrogênio no grupo amina (= N-H) de uma ligação peptídica tem uma pequena carga positiva.

É comum e fácil, portanto, que uma força de atração, chamada de ligação de hidrogênio, se forme entre duas ligações peptídicas diferentes. Embora as ligações de hidrogênio sejam forças de atração muito fracas, se houver um número suficiente delas, podem resultar maiores forças de modelagem.

Uma delas é a folha pregueada Beta (ou folha beta), que ocorre quando dois comprimentos de polipeptídeo correm em direções opostas (antiparalelas) um ao outro. Esse é o caso de uma das moléculas de anticorpo e de muitas proteínas globulares.

Um pedaço de polipeptídeo se dobra sobre si mesmo várias vezes, formando um arranjo em "sanduíche". Esses comprimentos de cadeia são mantidos um ao outro por ligações de hidrogênio formadas entre ligações peptídicas em comprimentos opostos. Esta folha beta antiparalela raramente é perfeita, e muitas vezes é ligeiramente torcida e menos regular que a forma ideal, uma vez que grupos R de tamanhos diferentes podem distorcer a molécula e nem todas as ligações peptídicas estão envolvidas na formação de ligações de hidrogênio.

Quando as ligações de hidrogênio se formam entre as ligações peptídicas ao longo do mesmo comprimento da cadeia polipeptídica, ocorre um tipo diferente de estrutura intramolecular.

Esta é a alfa-hélice, uma espiral de polipeptídeo semelhante a uma mola que se forma em um cilindro rígido de grande regularidade. Nesse tipo de estrutura, uma ligação de hidrogênio se forma entre um aminoácido e quatro aminoácidos mais adiante na cadeia.

Em uma alfa-hélice perfeita, portanto, cada ligação peptídica é ligada por hidrogênio a duas outras ligações peptídicas no comprimento da cadeia, mas isso raramente é o caso em proteínas naturais. Quando rodeada por água, uma alfa-hélice geralmente não é estável, mas é encontrada em muitas proteínas transmembrana (aquelas que passam pela bicamada lipídica da membrana plasmática), onde o ambiente hidrofóbico ajuda a estabilizar o cilindro de aminoácidos.

O dobramento muda as propriedades da cadeia polipeptídica bruta, transformando-a em uma forma tridimensional que tem um papel biológico a desempenhar dentro da célula e do organismo vivo. Quando totalmente dobradas, as proteínas exibem uma incrível gama de propriedades e incrível versatilidade de funções.

A propriedade de um polipeptídeo que determina todas as outras propriedades é a sequência de aminoácidos ao longo de seu comprimento. Esta é a estrutura primária da proteína produzida pela interpretação do código genético. Não há nada, entretanto, dentro da estrutura primária de uma cadeia polipeptídica que automaticamente dê à proteína final suas propriedades biológicas.

Quando forças intramoleculares, como ligações de hidrogênio, unem partes da cadeia polipeptídica em estruturas regulares e repetitivas, como a alfa-hélice ou a folha beta-pregueada, a cadeia encurta. Um polipeptídeo de 300 aminoácidos de comprimento encurta para cerca de metade desse comprimento quando dobrado em uma alfa-hélice e menos de 10 por cento desse comprimento quando dobrado em uma folha beta-pregueada. Quando enrolado em uma bola, o tamanho pode ser ainda menor. Essas são as estruturas secundárias da proteína final e são o primeiro nível de dobramento que produzirá a forma definitiva da proteína.

É raro, entretanto, que a forma de uma proteína inteira seja feita de apenas uma dessas estruturas secundárias. Muito mais comum é um comprimento de polipeptídeo dobrar em uma região de alfa-hélice, seguido por uma região de passeio aleatório sem padrão de repetição, seguido por outra região de alfa-hélice e assim por diante.

Uma proteína globular pode ter uma região principal de folha pregueada beta, várias regiões de hélice alfa e várias outras de caminhada aleatória entre seu terminal N e seu terminal C.

Essas regiões, ou domínios, podem ser pensados ​​como módulos de estrutura secundária dentro da estrutura tridimensional final geral da macromolécula de proteína.

Combinar os domínios da estrutura secundária com as forças ainda maiores de interação com a água circundante (hidrofílica para o exterior, hidrofóbica para o interior) produz uma forma totalmente formada, característica, forma tridimensional ou estrutura terciária que muitas vezes é o nível mais alto de estrutura alcançada por muitas proteínas.

É nesse nível de forma que as proteínas freqüentemente começam a mostrar suas propriedades biológicas e são capazes de cumprir sua função designada. A forma é muito importante para este papel biológico e se a proteína for forçada a uma forma diferente, ou for levada a perder essa forma, então o papel e as propriedades da proteína são perdidos ao mesmo tempo.

Essa mudança de forma e perda de função é chamada de desnaturação, e uma proteína desnaturada geralmente é inútil, reforçando fortemente a ideia de que a forma é uma propriedade crítica de todas as proteínas.

Um quarto nível de estrutura, a estrutura quaternária, é encontrado em proteínas muito grandes ou proteínas muito complexas. Estes geralmente consistem em mais de uma subunidade dobrada (feita de outros polipeptídeos) e freqüentemente possuem adições não-proteicas, como lipídeos, carboidratos, polinucleotídeos e até mesmo anéis heterocíclicos.

Essa hierarquia de níveis de estrutura provavelmente não tem relação óbvia com o funcionamento da proteína, mas pode representar a progressão pela qual uma célula precisa passar para produzir uma proteína em pleno funcionamento.